A fast and easy to use, moddable, Python based Minecraft server!

Related tags

Deep Learningpythonminecraftserverasyncminecraft-serverpluginsasynciopymcmcmc-serverminecraftserverjava-editionmcjeplugins-apimcserverpyminepythonminepythonminecraftmcpyasync-networking
Overview

PyMine

discord views quality contributors code size build status code style

PyMine - The fastest, easiest to use, Python-based Minecraft Server!

Features

Note: This list is not always up to date, and doesn't contain all the features that PyMine offers

  • Joinable - the login process is complete, but users can not yet join the world
  • Packet Models - missing some clientbound packets
  • Status + Login Logic - completed
  • Play Logic - currently a work in progress
  • World Generation - superflat world generation has been started
  • Entities/Entity AI - not started yet
  • Plugin API - completed, but more will be added as the development continues
  • Command/Argument Parsing - currently a work in progress
  • Query Support - completed
  • RCON Support - not started yet

Contributing

Installation / Usage

Check out the docs for more info

Installing from source

  • First, clone the repository git clone https://github.com/py-mine/PyMine.git and move into that directory (cd PyMine)
  • Next, install the required Python packages via pip (python3 -m pip install -r requirements.txt)
  • To run the server, you should run python3 pymine.
  • It is recommended you do not use regular Python, but PyPy3

API/Plugin Examples

Contributors ✨

Thanks goes to these wonderful people (emoji key):


Milo Weinberg
πŸ’» 🎨 πŸ”Œ πŸ”£ πŸ§‘β€πŸ« πŸ“– πŸ’¬ πŸ› πŸ’‘ πŸ€” πŸ“† πŸ‘€ ⚠️
Sh-wayz
πŸ’» πŸ› πŸ“– πŸ’‘ πŸ’¬ πŸ‘€ ⚠️ πŸ“†
Ammar-sys
πŸ“–
Treyver Reicha
πŸ’» πŸ‘€ πŸ€” πŸ› πŸ“† ⚠️
Paul Przybyszewski
πŸ’»
Ashwin Vinod
πŸ€” πŸ’» πŸ“–
imSofi
πŸ›

Kevin Thomas
πŸ€”
Milan Mehra
πŸ€”

This project follows the all-contributors specification. Contributions of any kind welcome!

Owner
PyMine
PyMine
GitHub Repository
Auto White-Balance Correction for Mixed-Illuminant Scenes

Auto White-Balance Correction for Mixed-Illuminant Scenes Mahmoud Afifi, Marcus A. Brubaker, and Michael S. Brown York University Video Reference code

Mahmoud Afifi 47 Nov 26, 2022
Voice of Pajlada with model and weights.

Pajlada TTS Stripped down version of ForwardTacotron (https://github.com/as-ideas/ForwardTacotron) with pretrained weights for Pajlada's (https://gith

6 Sep 03, 2021
PyDEns is a framework for solving Ordinary and Partial Differential Equations (ODEs & PDEs) using neural networks

PyDEns PyDEns is a framework for solving Ordinary and Partial Differential Equations (ODEs & PDEs) using neural networks. With PyDEns one can solve PD

Data Analysis Center 220 Dec 26, 2022
Food Drinks and groceries Images Multi Lingual (FooDI-ML) dataset.

Food Drinks and groceries Images Multi Lingual (FooDI-ML) dataset.

41 Jan 04, 2023
Official PyTorch implementation of "IntegralAction: Pose-driven Feature Integration for Robust Human Action Recognition in Videos", CVPRW 2021

IntegralAction: Pose-driven Feature Integration for Robust Human Action Recognition in Videos Introduction This repo is official PyTorch implementatio

Gyeongsik Moon 29 Sep 24, 2022
Credo AI Lens is a comprehensive assessment framework for AI systems. Lens standardizes model and data assessment, and acts as a central gateway to assessments created in the open source community.

Lens by Credo AI - Responsible AI Assessment Framework Lens is a comprehensive assessment framework for AI systems. Lens standardizes model and data a

Credo AI 27 Dec 14, 2022
IOT: Instance-wise Layer Reordering for Transformer Structures

Introduction This repository contains the code for Instance-wise Ordered Transformer (IOT), which is introduced in the ICLR2021 paper IOT: Instance-wi

IOT 19 Nov 15, 2022
Dynamic Divide-and-Conquer Adversarial Training for Robust Semantic Segmentation （ICCV2021οΌ‰

Dynamic Divide-and-Conquer Adversarial Training for Robust Semantic Segmentation This is a pytorch project for the paper Dynamic Divide-and-Conquer Ad

DV Lab 29 Nov 21, 2022
Compares various time-series feature sets on computational performance, within-set structure, and between-set relationships.

feature-set-comp Compares various time-series feature sets on computational performance, within-set structure, and between-set relationships. Reposito

Trent Henderson 7 May 25, 2022
Apache Flink

Apache Flink Apache Flink is an open source stream processing framework with powerful stream- and batch-processing capabilities. Learn more about Flin

The Apache Software Foundation 20.4k Dec 30, 2022
Hierarchical Metadata-Aware Document Categorization under Weak Supervision (WSDM'21)

Hierarchical Metadata-Aware Document Categorization under Weak Supervision This project provides a weakly supervised framework for hierarchical metada

Yu Zhang 53 Sep 17, 2022
Code of the paper "Part Detector Discovery in Deep Convolutional Neural Networks" by Marcel Simon, Erik Rodner and Joachim Denzler

Part Detector Discovery This is the code used in our paper "Part Detector Discovery in Deep Convolutional Neural Networks" by Marcel Simon, Erik Rodne

Computer Vision Group Jena 17 Feb 22, 2022
Large scale embeddings on a single machine.

Marius Marius is a system under active development for training embeddings for large-scale graphs on a single machine. Training on large scale graphs

Marius 107 Jan 03, 2023
Python implementation of "Multi-Instance Pose Networks: Rethinking Top-Down Pose Estimation"

MIPNet: Multi-Instance Pose Networks This repository is the official pytorch python implementation of "Multi-Instance Pose Networks: Rethinking Top-Do

Rawal Khirodkar 57 Dec 12, 2022
Official repository for Few-shot Image Generation via Cross-domain Correspondence (CVPR '21)

Few-shot Image Generation via Cross-domain Correspondence Utkarsh Ojha, Yijun Li, Jingwan Lu, Alexei A. Efros, Yong Jae Lee, Eli Shechtman, Richard Zh

Utkarsh Ojha 251 Dec 11, 2022
face property detection pytorch

This is the face property train code of project face-detection-project

i am x 2 Oct 18, 2021
A unified 3D Transformer Pipeline for visual synthesis

Overview This is the official repo for the paper: NÜWA: Visual Synthesis Pre-training for Neural visUal World creAtion. NÜWA is a unified multimodal p

Microsoft 2.6k Jan 06, 2023
Implementation and replication of ProGen, Language Modeling for Protein Generation, in Jax

ProGen - (wip) Implementation and replication of ProGen, Language Modeling for Protein Generation, in Pytorch and Jax (the weights will be made easily

Phil Wang 71 Dec 01, 2022
Enabling dynamic analysis of Legacy Embedded Systems in full emulated environment

PENecro This project is based on "Enabling dynamic analysis of Legacy Embedded Systems in full emulated environment", published on hardwear.io USA 202

Ta-Lun Yen 10 May 17, 2022
Pytorch implementation of Distributed Proximal Policy Optimization: https://arxiv.org/abs/1707.02286

Pytorch-DPPO Pytorch implementation of Distributed Proximal Policy Optimization: https://arxiv.org/abs/1707.02286 Using PPO with clip loss (from https

Alexis David Jacq 163 Dec 26, 2022