Reaction SMILES-AA mapping via language modelling

Related tags

Deep Learningrxnaamapper
Overview

rxn-aa-mapper

Reactions SMILES-AA sequence mapping

setup

conda env create -f conda.yml
conda activate rxn_aa_mapper

In the following we consider on examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:

from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer

tokenizer = EnzymaticReactionBertTokenizer(
    vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")

train the model

The mlm-trainer script can be used to train a model via MTL:

mlm-trainer \
    ./examples/data-samples/biochemical ./examples/data-samples/biochemical \  # just a sample, simply split data in a train and a validation folder
    ./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
    ./examples/sample-config.json "*.csv" 1 \  # for a more realistic config see ./examples/config.json
    ./examples/data-samples/organic ./examples/data-samples/organic \  # just a sample, simply split data in a train and a validation folder
    ./examples/token_75K_min_600_max_750_500K.json

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

Those can be turned into an HuggingFace model by simply running:

checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.

from rxn_aa_mapper.aa_mapper import RXNAAMapper

config_mapper = {
    "vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    "aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
    "model_path": "/tmp/rxnaamapper-pretrained-model",
    "head": 3,
    "layers": [11],
    "top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])

citation

@article{dassi2021identification,
  title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
  author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
  year={2021}
  conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
Owner
GitHub Repository
Rule-based Customer Segmentation

Rule-based Customer Segmentation Business Problem A game company wants to create level-based new customer definitions (personas) by using some feature

Cem Çaluk 2 Jan 03, 2022
codebase for "A Theory of the Inductive Bias and Generalization of Kernel Regression and Wide Neural Networks"

Eigenlearning This repo contains code for replicating the experiments of the paper A Theory of the Inductive Bias and Generalization of Kernel Regress

Jamie Simon 45 Dec 02, 2022
PyTorch implementation of CVPR 2020 paper (Reference-Based Sketch Image Colorization using Augmented-Self Reference and Dense Semantic Correspondence) and pre-trained model on ImageNet dataset

Reference-Based-Sketch-Image-Colorization-ImageNet This is a PyTorch implementation of CVPR 2020 paper (Reference-Based Sketch Image Colorization usin

Yuzhi ZHAO 11 Jul 28, 2022
Tensorflow/Keras Plug-N-Play Deep Learning Models Compilation

DeepBay This project was created with the objective of compile Machine Learning Architectures created using Tensorflow or Keras. The architectures mus

Whitman Bohorquez 4 Sep 26, 2022
Tensorflow python implementation of "Learning High Fidelity Depths of Dressed Humans by Watching Social Media Dance Videos"

Learning High Fidelity Depths of Dressed Humans by Watching Social Media Dance Videos This repository is the official tensorflow python implementation

Yasamin Jafarian 287 Jan 06, 2023
Second-order Attention Network for Single Image Super-resolution (CVPR-2019)

Second-order Attention Network for Single Image Super-resolution (CVPR-2019) "Second-order Attention Network for Single Image Super-resolution" is pub

516 Dec 28, 2022
Using Machine Learning to Create High-Res Fine Art

BIG.art: Using Machine Learning to Create High-Res Fine Art How to use GLIDE and BSRGAN to create ultra-high-resolution paintings with fine details By

Robert A. Gonsalves 13 Nov 27, 2022
Visual Question Answering in Pytorch

Visual Question Answering in pytorch /!\ New version of pytorch for VQA available here: https://github.com/Cadene/block.bootstrap.pytorch This repo wa

Remi 672 Jan 01, 2023
PyTorch implementations of the paper: "DR.VIC: Decomposition and Reasoning for Video Individual Counting, CVPR, 2022"

DRNet for Video Indvidual Counting (CVPR 2022) Introduction This is the official PyTorch implementation of paper: DR.VIC: Decomposition and Reasoning

tao han 35 Nov 22, 2022
All materials of Cassandra Event, Udyam'22

Cassandra 2022 Workspace Workshop Materials Workshop-1 Workshop-2 Workshop-3 Workshop-4 Assignments Assignment-1 Assignment-2 Assignment-3 Resources P

36 Dec 31, 2022
An example project demonstrating how the Autonomous Learning Library can be used to build new reinforcement learning agents.

About This repository shows how Autonomous Learning Library can be used to build new reinforcement learning agents. In particular, it contains a model

Chris Nota 5 Aug 30, 2022
style mixing for animation face

An implementation of StyleGAN on Animation dataset. Install git clone https://github.com/MorvanZhou/anime-StyleGAN cd anime-StyleGAN pip install -r re

Morvan 46 Nov 30, 2022
Code for "Diffusion is All You Need for Learning on Surfaces"

Source code for "Diffusion is All You Need for Learning on Surfaces", by Nicholas Sharp Souhaib Attaiki Keenan Crane Maks Ovsjanikov NOTE: the linked

Nick Sharp 247 Dec 28, 2022
A colab notebook for training Stylegan2-ada on colab, transfer learning onto your own dataset.

Stylegan2-Ada-Google-Colab-Starter-Notebook A no thrills colab notebook for training Stylegan2-ada on colab. transfer learning onto your own dataset h

Harnick Khera 66 Dec 16, 2022
Implementation of the Paper: "Parameterized Hypercomplex Graph Neural Networks for Graph Classification" by Tuan Le, Marco Bertolini, Frank Noé and Djork-Arné Clevert

Parameterized Hypercomplex Graph Neural Networks (PHC-GNNs) PHC-GNNs (Le et al., 2021): https://arxiv.org/abs/2103.16584 PHM Linear Layer Illustration

Bayer AG 26 Aug 11, 2022
Simple API for UCI Machine Learning Dataset Repository (search, download, analyze)

A simple API for working with University of California, Irvine (UCI) Machine Learning (ML) repository Table of Contents Introduction About Page of the

Tirthajyoti Sarkar 223 Dec 05, 2022
A project that uses optical flow and machine learning to detect aimhacking in video clips.

waldo-anticheat A project that aims to use optical flow and machine learning to visually detect cheating or hacking in video clips from fps games. Che

waldo.vision 542 Dec 03, 2022
SE3 Pose Interp - Interpolate camera pose or trajectory in SE3, pose interpolation, trajectory interpolation

SE3 Pose Interpolation Pose estimated from SLAM system are always discrete, and

Ran Cheng 4 Dec 15, 2022
Open source simulator for autonomous vehicles built on Unreal Engine / Unity, from Microsoft AI & Research

Welcome to AirSim AirSim is a simulator for drones, cars and more, built on Unreal Engine (we now also have an experimental Unity release). It is open

Microsoft 13.8k Jan 05, 2023
Codes and pretrained weights for winning submission of 2021 Brain Tumor Segmentation (BraTS) Challenge

Winning submission to the 2021 Brain Tumor Segmentation Challenge This repo contains the codes and pretrained weights for the winning submission to th

94 Dec 28, 2022