peptides.py is a pure-Python package to compute common descriptors for protein sequences

Overview

peptides.py Stars

Physicochemical properties and indices for amino-acid sequences.

Actions Coverage PyPI Wheel Python Versions Python Implementations License Source Mirror GitHub issues Changelog Downloads

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] ">
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...
Python Package for DataHerb: create, search, and load datasets.
Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

sportsdataverse python package
sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

PyEmits, a python package for easy manipulation in time-series data.
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

VevestaX is an open source Python package for ML Engineers and Data Scientists.
VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

Comments
  • Per-residue data

    Per-residue data

    It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.

    enhancement 
    opened by multimeric 1
  • Hydrophobic moment is inconsistent with R version

    Hydrophobic moment is inconsistent with R version

    Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

    Example in python:

    >>> import peptides`
    >>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
    0.0
    >>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
    0.0
    >>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
    0.31847187610377536
    

    Example in R:

    > library(Peptides)
    > hmoment(seq="MLK", window=5, angle=100)
    [1] 0.8099386
    > hmoment(seq="AACQ", window=5, angle=100)
    [1] 0.3152961
    > hmoment(seq="FGGIQ", window=5, angle=100)
    [1] 0.3184719
    

    I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

    --- a/peptides/__init__.py
    +++ b/peptides/__init__.py
    @@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
                   :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.
    
             """
    +        window = min(window, len(self))
             scale = tables.HYDROPHOBICITY["Eisenberg"]
             lut = [scale.get(aa, 0.0) for aa in self._CODE1]
             angles = [(angle * i) % 360 for i in range(window)]
    
    bug 
    opened by eotovic 1
  • RuntimeWarning in auto_correlation function()

    RuntimeWarning in auto_correlation function()

    Hi, thank you for creating peptides.py.

    Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

    import peptides
    
    for hydro in peptides.tables.HYDROPHOBICITY.keys():
        print(hydro)
        table = peptides.tables.HYDROPHOBICITY[hydro]
        peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)
    

    Warning (s2 == 0):

    RuntimeWarning: invalid value encountered in double_scalars
      return s1 / s2
    

    The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']

    opened by jhahnfeld 0
Releases(v0.3.1)
  • v0.3.1(Sep 1, 2022)

  • v0.3.0(Sep 1, 2022)

    Added

    • Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).
    • Peptide.profile to build a generic per-residue profile from a data table (#3).
    Source code(tar.gz)
    Source code(zip)
  • v0.2.0(Oct 25, 2021)

    Added

    • Peptide.counts method to get the number of occurences of each amino acid in the peptide.
    • Peptide.frequencies to get the frequencies of each amino acid in the peptide.
    • Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).
    • Peptide.sneath_vectors to compute the descriptors from Sneath (1966).
    • Hydrophilicity descriptors from Barley (2018).
    • Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

    Changed

    • Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).
    • Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.
    • Some Peptide functions now support vectorized code using numpy if available.
    Source code(tar.gz)
    Source code(zip)
  • v0.1.0(Oct 21, 2021)

Owner
Martin Larralde
PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.
Martin Larralde
A set of functions and analysis classes for solvation structure analysis

SolvationAnalysis The macroscopic behavior of a liquid is determined by its microscopic structure. For ionic systems, like batteries and many enzymes,

MDAnalysis 19 Nov 24, 2022
A Python package for the mathematical modeling of infectious diseases via compartmental models

A Python package for the mathematical modeling of infectious diseases via compartmental models. Originally designed for epidemiologists, epispot can be adapted for almost any type of modeling scenari

epispot 12 Dec 28, 2022
Flood modeling by 2D shallow water equation

hydraulicmodel Flood modeling by 2D shallow water equation. Refer to Hunter et al (2005), Bates et al. (2010). Diffusive wave approximation Local iner

6 Nov 30, 2022
Larch: Applications and Python Library for Data Analysis of X-ray Absorption Spectroscopy (XAS, XANES, XAFS, EXAFS), X-ray Fluorescence (XRF) Spectroscopy and Imaging

Larch: Data Analysis Tools for X-ray Spectroscopy and More Documentation: http://xraypy.github.io/xraylarch Code: http://github.com/xraypy/xraylarch L

xraypy 95 Dec 13, 2022
apricot implements submodular optimization for the purpose of selecting subsets of massive data sets to train machine learning models quickly.

Please consider citing the manuscript if you use apricot in your academic work! You can find more thorough documentation here. apricot implements subm

Jacob Schreiber 457 Dec 20, 2022
Shot notebooks resuming the main functions of GeoPandas

Shot notebooks resuming the main functions of GeoPandas, 2 notebooks written as Exercises to apply these functions.

1 Jan 12, 2022
A stock analysis app with streamlit

StockAnalysisApp A stock analysis app with streamlit. You select the ticker of the stock and the app makes a series of analysis by using the price cha

Antonio Catalano 50 Nov 27, 2022
Statistical Rethinking: A Bayesian Course Using CmdStanPy and Plotnine

Statistical Rethinking: A Bayesian Course Using CmdStanPy and Plotnine Intro This repo contains the python/stan version of the Statistical Rethinking

Andrés Suárez 3 Nov 08, 2022
Pipetools enables function composition similar to using Unix pipes.

Pipetools Complete documentation pipetools enables function composition similar to using Unix pipes. It allows forward-composition and piping of arbit

186 Dec 29, 2022
A crude Hy handle on Pandas library

Quickstart Hyenas is a curde Hy handle written on top of Pandas API to allow for more elegant access to data-scientist's powerhouse that is Pandas. In

Peter Výboch 4 Sep 05, 2022
DaCe is a parallel programming framework that takes code in Python/NumPy and other programming languages

aCe - Data-Centric Parallel Programming Decoupling domain science from performance optimization. DaCe is a parallel programming framework that takes c

SPCL 330 Dec 30, 2022
Powerful, efficient particle trajectory analysis in scientific Python.

freud Overview The freud Python library provides a simple, flexible, powerful set of tools for analyzing trajectories obtained from molecular dynamics

Glotzer Group 195 Dec 20, 2022
PyStan, a Python interface to Stan, a platform for statistical modeling. Documentation: https://pystan.readthedocs.io

PyStan PyStan is a Python interface to Stan, a package for Bayesian inference. Stan® is a state-of-the-art platform for statistical modeling and high-

Stan 229 Dec 29, 2022
An orchestration platform for the development, production, and observation of data assets.

Dagster An orchestration platform for the development, production, and observation of data assets. Dagster lets you define jobs in terms of the data f

Dagster 6.2k Jan 08, 2023
Tools for the analysis, simulation, and presentation of Lorentz TEM data.

ltempy ltempy is a set of tools for Lorentz TEM data analysis, simulation, and presentation. Features Single Image Transport of Intensity Equation (SI

McMorran Lab 1 Dec 26, 2022
Pandas and Spark DataFrame comparison for humans

DataComPy DataComPy is a package to compare two Pandas DataFrames. Originally started to be something of a replacement for SAS's PROC COMPARE for Pand

Capital One 259 Dec 24, 2022
Deep universal probabilistic programming with Python and PyTorch

Getting Started | Documentation | Community | Contributing Pyro is a flexible, scalable deep probabilistic programming library built on PyTorch. Notab

7.7k Dec 30, 2022
InDels analysis of CRISPR lines by NGS amplicon sequencing technology for a multicopy gene family.

CRISPRanalysis InDels analysis of CRISPR lines by NGS amplicon sequencing technology for a multicopy gene family. In this work, we present a workflow

2 Jan 31, 2022
Senator Trades Monitor

Senator Trades Monitor This monitor will grab the most recent trades by senators and send them as a webhook to discord. Installation To use the monito

Yousaf Cheema 5 Jun 11, 2022
A Pythonic introduction to methods for scaling your data science and machine learning work to larger datasets and larger models, using the tools and APIs you know and love from the PyData stack (such as numpy, pandas, and scikit-learn).

This tutorial's purpose is to introduce Pythonistas to methods for scaling their data science and machine learning work to larger datasets and larger models, using the tools and APIs they know and lo

Coiled 102 Nov 10, 2022